Lineage for d1tipa_ (1tip A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247122Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 247123Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 247197Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)
  6. 247198Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
    bifunctional enzyme
  7. 247202Species Rat (Rattus norvegicus) [TaxId:10116] [53269] (5 PDB entries)
  8. 247206Domain d1tipa_: 1tip A: [34006]

Details for d1tipa_

PDB Entry: 1tip (more details), 2.2 Å

PDB Description: the bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase

SCOP Domain Sequences for d1tipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tipa_ c.60.1.4 (A:) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus)}
mrsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrti
qtaealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyed
lvqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvay
gcrvesiylnv

SCOP Domain Coordinates for d1tipa_:

Click to download the PDB-style file with coordinates for d1tipa_.
(The format of our PDB-style files is described here.)

Timeline for d1tipa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tipb_