Lineage for d5xs4b_ (5xs4 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822568Species Coxsackievirus a6 [TaxId:86107] [339715] (1 PDB entry)
  8. 2822570Domain d5xs4b_: 5xs4 B: [339716]
    Other proteins in same PDB: d5xs4c_
    automated match to d4jgyb_

Details for d5xs4b_

PDB Entry: 5xs4 (more details), 3.1 Å

PDB Description: structure of coxsackievirus a6 (cva6) virus a-particle
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5xs4b_:

Sequence, based on SEQRES records: (download)

>d5xs4b_ b.121.4.0 (B:) automated matches {Coxsackievirus a6 [TaxId: 86107]}
nivlsygewpeycpstdatavdkptrpdvsvnrfytlstkswktestgwywkfpdvlndt
gvfgqnaqfhylyrsgfcmhvqcnaskfhqgallvaaipefviaasspatkpngrglypd
fahtnpgkdgqefrdpyvldagiplsqalvfphqwinlrtnncatiimpyvnalpfdsal
nhsnfglvvipisplkycngattevpvtltiaplnsefsgl

Sequence, based on observed residues (ATOM records): (download)

>d5xs4b_ b.121.4.0 (B:) automated matches {Coxsackievirus a6 [TaxId: 86107]}
nivlsygewpeycptrpdvsvnrfytlstkswktestgwywkfpdvlndtgvfgqnaqfh
ylyrsgfcmhvqcnaskfhqgallvaaipefviaassplypdfahtnpgkdgqefrdpyv
ldagiplsqalvfphqwinlrtnncatiimpyvnalpfdsalnhsnfglvvipisplkyc
ngattevpvtltiaplnsefsgl

SCOPe Domain Coordinates for d5xs4b_:

Click to download the PDB-style file with coordinates for d5xs4b_.
(The format of our PDB-style files is described here.)

Timeline for d5xs4b_: