SCOPe 2.08: Domain d5xs4c_: 5xs4 C:

Lineage for d5xs4c_ (5xs4 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Coxsackievirus a6 [TaxId:86107] [339711] (2 PDB entries)

8. Domain d5xs4c_: 5xs4 C: [339712]
   Other proteins in same PDB: d5xs4a1, d5xs4b_
   automated match to d5c8cc_

Details for d5xs4c_

PDB Entry: 5xs4, 3.1 Å

PDB Description: structure of coxsackievirus a6 (cva6) virus a-particle

PDB Compounds: (C:) Genome polyprotein

SCOPe Domain Sequences for d5xs4c_:

Sequence, based on SEQRES records:

>d5xs4c_ b.121.4.1 (C:) automated matches {Coxsackievirus a6 [TaxId: 86107]}
ptelkpgtnqflttddgtsppilpgfeptplihipgeftslldlcqietilevnnttgti
gvsrllipvraqnnvdqlcasfqvdpgrngpwqstmvgqicryytqwsgslkvtfmftgs
fmatgkmliaytppgsaqpatreaamlgthivwdfglqssvtlvipwisnthfravkigg
vydyyatgivtiwyqtnfvvppdtpteaniialgaaqknftlklckdt

Sequence, based on observed residues (ATOM records):

>d5xs4c_ b.121.4.1 (C:) automated matches {Coxsackievirus a6 [TaxId: 86107]}
ptelkpgtnqflttddgtsppilpgfeptplihipgeftslldlcqietilevnnttigv
srllipvraqnnvdqlcasfqvdpgrngpwqstmvgqicryytqwsgslkvtfmftgsfm
atgkmliaytppgsaqpatreaamlgthivwdfglqssvtlvipwisntgivtiwyqtnf
vvppdtpteaniialgaaqknftlklckdt

Timeline for d5xs4c_:

• d5xs4c_ first appeared in SCOPe 2.06
  
• d5xs4c_ appears in SCOPe 2.07