Lineage for d5vn5b_ (5vn5 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2420241Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2420242Protein automated matches [190150] (26 species)
    not a true protein
  7. 2420385Species Sphingobium sp. [TaxId:627192] [339663] (1 PDB entry)
  8. 2420387Domain d5vn5b_: 5vn5 B: [339671]
    Other proteins in same PDB: d5vn5c2
    automated match to d4ofca_
    complexed with cl, zn

Details for d5vn5b_

PDB Entry: 5vn5 (more details), 1.9 Å

PDB Description: crystal structure of ligy from sphingobium sp. strain syk-6
PDB Compounds: (B:) 2,2',3-trihydroxy-3'-methoxy-5,5'-dicarboxybiphenyl meta-cleavage compound hydrolase

SCOPe Domain Sequences for d5vn5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vn5b_ c.1.9.0 (B:) automated matches {Sphingobium sp. [TaxId: 627192]}
miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
iapfiqkfdflsdadkklifednarkvfnlev

SCOPe Domain Coordinates for d5vn5b_:

Click to download the PDB-style file with coordinates for d5vn5b_.
(The format of our PDB-style files is described here.)

Timeline for d5vn5b_: