Lineage for d4ofca_ (4ofc A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. Protein automated matches [190150] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189102] (8 PDB entries)
  8. Domain d4ofca_: 4ofc A: [261117]
    automated match to d2wm1a_
    complexed with zn

Details for d4ofca_

PDB Entry: 4ofc (more details), 1.99 Å

PDB Description: 2.0 angstroms x-ray crystal structure of human 2-amino-3- carboxymuconate-6-semialdehye decarboxylase
PDB Compounds: (A:) 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

SCOPe Domain Sequences for d4ofca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ofca_ c.1.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkidihshilpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwdpevri
remdqkgvtvqalstvpvmfsywakpedtlnlcqllnndlastvvsyprrfvglgtlpmq
apelavkemercvkelgfpgvqigthvnewdlnaqelfpvyaaaerlkcslfvhpwdmqm
dgrmakywlpwlvgmpaettiaicsmimggvfekfpklkvcfahgggafpftvgrishgf
smrpdlcaqdnpmnpkkylgsfytdalvhdplslklltdvigkdkvilgtdypfplgele
pgkliesmeefdeetknklkagnalaflglerkqf

SCOPe Domain Coordinates for d4ofca_ are not available.

Timeline for d4ofca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ofcb_, d4ofcc_, d4ofcd_, d4ofce_, d4ofcf_