Lineage for d1eeha2 (1eeh A:298-437)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1377309Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 1377310Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 1377311Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 1377328Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. 1377329Species Escherichia coli [TaxId:562] [53247] (11 PDB entries)
  8. 1377337Domain d1eeha2: 1eeh A:298-437 [33955]
    Other proteins in same PDB: d1eeha1, d1eeha3
    complexed with uma

Details for d1eeha2

PDB Entry: 1eeh (more details), 1.9 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOPe Domain Sequences for d1eeha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeha2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOPe Domain Coordinates for d1eeha2:

Click to download the PDB-style file with coordinates for d1eeha2.
(The format of our PDB-style files is described here.)

Timeline for d1eeha2: