Lineage for d1eeha2 (1eeh A:298-437)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25758Fold c.59: Glutamate ligase domain [53243] (1 superfamily)
  4. 25759Superfamily c.59.1: Glutamate ligase domain [53244] (2 families) (S)
  5. 25760Family c.59.1.1: MurD/MurF C-terminal domain [53245] (2 proteins)
  6. 25761Protein MurD (UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase) [53246] (1 species)
  7. 25762Species Escherichia coli [TaxId:562] [53247] (6 PDB entries)
  8. 25767Domain d1eeha2: 1eeh A:298-437 [33955]
    Other proteins in same PDB: d1eeha1, d1eeha3

Details for d1eeha2

PDB Entry: 1eeh (more details), 1.9 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d1eeha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeha2 c.59.1.1 (A:298-437) MurD (UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase) {Escherichia coli}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOP Domain Coordinates for d1eeha2:

Click to download the PDB-style file with coordinates for d1eeha2.
(The format of our PDB-style files is described here.)

Timeline for d1eeha2: