![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
![]() | Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) ![]() |
![]() | Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins) |
![]() | Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [51987] (11 PDB entries) |
![]() | Domain d1eeha1: 1eeh A:1-93 [30654] Other proteins in same PDB: d1eeha2, d1eeha3 complexed with uma |
PDB Entry: 1eeh (more details), 1.9 Å
SCOPe Domain Sequences for d1eeha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eeha1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde wlmaadlivaspgialahpslsaaadagieivg
Timeline for d1eeha1: