Lineage for d1efka2 (1efk A:21-279)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25651Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 25652Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 25741Family c.58.1.3: Mitochondrial NAD(P)-dependenent malic enzyme [53240] (1 protein)
  6. 25742Protein Mitochondrial NAD(P)-dependenent malic enzyme [53241] (1 species)
  7. 25743Species Human (Homo sapiens) [TaxId:9606] [53242] (4 PDB entries)
  8. 25754Domain d1efka2: 1efk A:21-279 [33947]
    Other proteins in same PDB: d1efka1, d1efkb1, d1efkc1, d1efkd1

Details for d1efka2

PDB Entry: 1efk (more details), 2.6 Å

PDB Description: structure of human malic enzyme in complex with ketomalonate

SCOP Domain Sequences for d1efka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efka2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependenent malic enzyme {Human (Homo sapiens)}
ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
nafrflrkyrekyctfndd

SCOP Domain Coordinates for d1efka2:

Click to download the PDB-style file with coordinates for d1efka2.
(The format of our PDB-style files is described here.)

Timeline for d1efka2: