Lineage for d1efkc1 (1efk C:280-573)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20664Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 20741Protein Mitochondrial NAD(P)-dependenent malic enzyme [51898] (1 species)
  7. 20742Species Human (Homo sapiens) [TaxId:9606] [51899] (4 PDB entries)
  8. 20755Domain d1efkc1: 1efk C:280-573 [30301]
    Other proteins in same PDB: d1efka2, d1efkb2, d1efkc2, d1efkd2

Details for d1efkc1

PDB Entry: 1efk (more details), 2.6 Å

PDB Description: structure of human malic enzyme in complex with ketomalonate

SCOP Domain Sequences for d1efkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efkc1 c.2.1.7 (C:280-573) Mitochondrial NAD(P)-dependenent malic enzyme {Human (Homo sapiens)}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOP Domain Coordinates for d1efkc1:

Click to download the PDB-style file with coordinates for d1efkc1.
(The format of our PDB-style files is described here.)

Timeline for d1efkc1: