SCOP 1.63: Domain d5cpa__: 5cpa -

Lineage for d5cpa__ (5cpa -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (25 PDB entries)

8. Domain d5cpa__: 5cpa - [33811]
   complexed with zn

Details for d5cpa__

PDB Entry: 5cpa, 1.54 Å

PDB Description: refined crystal structure of carboxypeptidase a at 1.54 angstroms resolution.

SCOP Domain Sequences for d5cpa__:

Sequence; same for both SEQRES and ATOM records:

>d5cpa__ c.56.5.1 (-) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

Timeline for d5cpa__:

• d5cpa__ first appeared (with stable ids) in SCOP 1.55
  
• d5cpa__ appears in SCOP 1.61
  
• d5cpa__ appears in SCOP 1.65
  
• d5cpa__ appears in the current release, SCOPe 2.08, called d5cpaa_