Lineage for d5cpa__ (5cpa -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317273Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 317453Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 317454Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 317455Protein Carboxypeptidase A [53189] (4 species)
  7. 317458Species Cow (Bos taurus) [TaxId:9913] [53190] (25 PDB entries)
  8. 317480Domain d5cpa__: 5cpa - [33811]
    complexed with zn

Details for d5cpa__

PDB Entry: 5cpa (more details), 1.54 Å

PDB Description: refined crystal structure of carboxypeptidase a at 1.54 angstroms resolution.

SCOP Domain Sequences for d5cpa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cpa__ c.56.5.1 (-) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOP Domain Coordinates for d5cpa__:

Click to download the PDB-style file with coordinates for d5cpa__.
(The format of our PDB-style files is described here.)

Timeline for d5cpa__: