Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
Protein Carboxypeptidase A [53189] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries) |
Domain d5cpaa_: 5cpa A: [33811] complexed with zn |
PDB Entry: 5cpa (more details), 1.54 Å
SCOPe Domain Sequences for d5cpaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cpaa_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti mehtvnn
Timeline for d5cpaa_: