Lineage for d5cpa__ (5cpa -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins) Protein Carboxypeptidase A [53189] (4 species) Species Cow (Bos taurus) [TaxId:9913] [53190] (23 PDB entries) 
Domain d5cpa__: 5cpa - [33811]
Details for d5cpa__
PDB Entry: 5cpa (more details), 1.54 Å
PDB Description: refined crystal structure of carboxypeptidase a at 1.54 angstroms resolution.
SCOP Domain Sequences for d5cpa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cpa__ c.56.5.1 (-) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn
SCOP Domain Coordinates for d5cpa__:
Click to download the PDB-style file with coordinates for d5cpa__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5cpa__:
- d5cpa__ first appeared (with stable ids) in SCOP 1.55
- d5cpa__ appears in SCOP 1.59
- d5cpa__ appears in SCOP 1.63
- d5cpa__ appears in the current release, SCOPe 2.08, called d5cpaa_
View in 3D