Lineage for d5my6a3 (5my6 A:345-510)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460208Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2460209Protein automated matches [190787] (14 species)
    not a true protein
  7. 2460223Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)
  8. 2460242Domain d5my6a3: 5my6 A:345-510 [337671]
    Other proteins in same PDB: d5my6a2, d5my6b1, d5my6b2
    automated match to d1n8zc2
    complexed with gol, nag

Details for d5my6a3

PDB Entry: 5my6 (more details), 2.25 Å

PDB Description: crystal structure of a her2-nb complex
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d5my6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5my6a3 c.10.2.0 (A:345-510) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetle
eitgylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsg
lalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegla

SCOPe Domain Coordinates for d5my6a3:

Click to download the PDB-style file with coordinates for d5my6a3.
(The format of our PDB-style files is described here.)

Timeline for d5my6a3: