SCOPe 2.07: Domain d5my6a1: 5my6 A:24-187

Lineage for d5my6a1 (5my6 A:24-187)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)

8. Domain d5my6a1: 5my6 A:24-187 [337669]
   Other proteins in same PDB: d5my6a2, d5my6b1, d5my6b2
   automated match to d1n8zc1
   complexed with gol, nag

Details for d5my6a1

PDB Entry: 5my6, 2.25 Å

PDB Description: crystal structure of a her2-nb complex

PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d5my6a1:

Sequence, based on SEQRES records:

>d5my6a1 c.10.2.0 (A:24-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqgy
vliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelqlr
slteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

Sequence, based on observed residues (ATOM records):

>d5my6a1 c.10.2.0 (A:24-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqgy
vliahnqvrqvplqrlrivrgtqlfednyalavldngdpaspgglrelqlrslteilkgg
vliqrnpqlcyqdtilwkdifhknnqlaltlidtn

Timeline for d5my6a1:

• d5my6a1 first appeared in SCOPe 2.06
  
• d5my6a1 appears in the current release, SCOPe 2.08