Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
Domain d5my6b1: 5my6 B:6-115 [337704] Other proteins in same PDB: d5my6a1, d5my6a2, d5my6a3, d5my6b2 automated match to d4ldeb_ complexed with gol, nag |
PDB Entry: 5my6 (more details), 2.25 Å
SCOPe Domain Sequences for d5my6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5my6b1 b.1.1.1 (B:6-115) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} esgggsvqaggslkltcaasgyifnscgmgwyrqspgrerelvsrisgdgdtwhkesvkg rftisqdnvkktlylqmnslkpedtavyfcavcynletywgqgtqvtvss
Timeline for d5my6b1: