SCOPe 2.07: Domain d1n8zc2: 1n8z C:323-488

Lineage for d1n8zc2 (1n8z C:323-488)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

Superfamily c.10.2: L domain-like [52058] (9 families)
less regular structure consisting of variable repeats
Family c.10.2.5: L domain [52071] (6 proteins)
this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
Protein Protooncoprotein Her2 extracellular domain [82328] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [82329] (2 PDB entries)
Domain d1n8zc2: 1n8z C:323-488 [80323]
Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zb2, d1n8zc3, d1n8zc4
complexed with nag, so4

Details for d1n8zc2

PDB Entry: 1n8z (more details), 2.52 Å

PDB Description: crystal structure of extracellular domain of human her2 complexed with herceptin fab

PDB Compounds: (C:) Receptor protein-tyrosine kinase erbB-2

SCOPe Domain Sequences for d1n8zc2:

Sequence, based on SEQRES records: (download)

>d1n8zc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
lgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetle
eitgylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsg
lalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegla

Sequence, based on observed residues (ATOM records): (download)

>d1n8zc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
lgmehlrevravtsaniqefagckkifgslaflpesfdsntaplqpeqlqvfetleeitg
ylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsglali
hhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegla

SCOPe Domain Coordinates for d1n8zc2:

Click to download the PDB-style file with coordinates for d1n8zc2.
(The format of our PDB-style files is described here.)

Timeline for d1n8zc2: