Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) |
Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) |
Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries) |
Domain d5ktqa1: 5ktq A:290-422 [33704] Other proteins in same PDB: d5ktqa2 |
PDB Entry: 5ktq (more details), 2.5 Å
SCOP Domain Sequences for d5ktqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ktqa1 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus} spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals erlfanlwgrleg
Timeline for d5ktqa1: