Lineage for d5ktqa1 (5ktq A:290-422)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) 
Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries) 
Domain d5ktqa1: 5ktq A:290-422 [33704]
Other proteins in same PDB: d5ktqa2
Details for d5ktqa1
PDB Entry: 5ktq (more details), 2.5 Å
PDB Description: large fragment of taq dna polymerase bound to dctp
SCOP Domain Sequences for d5ktqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ktqa1 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg
SCOP Domain Coordinates for d5ktqa1:
Click to download the PDB-style file with coordinates for d5ktqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ktqa1:
- d5ktqa1 appears in SCOP 1.57
- d5ktqa1 appears in the current release, SCOPe 2.08
View in 3D
