Lineage for d5ktqa1 (5ktq A:290-422)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72015Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 72183Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 72206Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 72227Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)
  8. 72237Domain d5ktqa1: 5ktq A:290-422 [33704]
    Other proteins in same PDB: d5ktqa2

Details for d5ktqa1

PDB Entry: 5ktq (more details), 2.5 Å

PDB Description: large fragment of taq dna polymerase bound to dctp

SCOP Domain Sequences for d5ktqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ktqa1 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

SCOP Domain Coordinates for d5ktqa1:

Click to download the PDB-style file with coordinates for d5ktqa1.
(The format of our PDB-style files is described here.)

Timeline for d5ktqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ktqa2