Lineage for d5ktqa1 (5ktq A:290-422)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886679Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 2886744Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries)
  8. 2886764Domain d5ktqa1: 5ktq A:290-422 [33704]
    Other proteins in same PDB: d5ktqa2
    complexed with dcp

Details for d5ktqa1

PDB Entry: 5ktq (more details), 2.5 Å

PDB Description: large fragment of taq dna polymerase bound to dctp
PDB Compounds: (A:) protein (DNA polymerase I)

SCOPe Domain Sequences for d5ktqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ktqa1 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

SCOPe Domain Coordinates for d5ktqa1:

Click to download the PDB-style file with coordinates for d5ktqa1.
(The format of our PDB-style files is described here.)

Timeline for d5ktqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ktqa2