![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
![]() | Domain d5njhf2: 5njh F:77-378 [335689] Other proteins in same PDB: d5njha1, d5njha2, d5njhb1, d5njhb2, d5njhc1, d5njhc2, d5njhd1, d5njhd2, d5njhe_, d5njhf1, d5njhf3 automated match to d3tiia2 complexed with 8z8, acp, gdp, gtp, mg |
PDB Entry: 5njh (more details), 2.39 Å
SCOPe Domain Sequences for d5njhf2:
Sequence, based on SEQRES records: (download)
>d5njhf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5njhf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptntderevflaaynrrregregnvwiaksgegil isseaselldfidvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtss epynsanfqdktchltnhciqkenygryeegnemffeefnqylmdalnttlensillqik hiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcq givdvaissvfplatsifikl
Timeline for d5njhf2: