Lineage for d5njha2 (5njh A:246-438)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (70 PDB entries)
  8. 2525650Domain d5njha2: 5njh A:246-438 [335807]
    Other proteins in same PDB: d5njha1, d5njhb1, d5njhc1, d5njhd1, d5njhe_, d5njhf1, d5njhf2, d5njhf3
    automated match to d4i50a2
    complexed with 8z8, acp, gdp, gtp, mg

Details for d5njha2

PDB Entry: 5njh (more details), 2.39 Å

PDB Description: triazolopyrimidines stabilize microtubules by binding to the vinca inhibitor site of tubulin
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5njha2:

Sequence, based on SEQRES records: (download)

>d5njha2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

Sequence, based on observed residues (ATOM records): (download)

>d5njha2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekaqlsvaeitnacfepanqmvkcdpr
hgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggdl
akvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaal
ekdyeevgvd

SCOPe Domain Coordinates for d5njha2:

Click to download the PDB-style file with coordinates for d5njha2.
(The format of our PDB-style files is described here.)

Timeline for d5njha2: