![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (2 proteins) |
![]() | Protein Stathmin 4 [101496] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
![]() | Domain d5njhe_: 5njh E: [335654] Other proteins in same PDB: d5njha1, d5njha2, d5njhb1, d5njhb2, d5njhc1, d5njhc2, d5njhd1, d5njhd2, d5njhf1, d5njhf2, d5njhf3 automated match to d4i55e_ complexed with 8z8, acp, gdp, gtp, mg |
PDB Entry: 5njh (more details), 2.39 Å
SCOPe Domain Sequences for d5njhe_:
Sequence, based on SEQRES records: (download)
>d5njhe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5njhe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d5njhe_: