SCOPe 2.08: Domain d5njhc2: 5njh C:246-440

Lineage for d5njhc2 (5njh C:246-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d5njhc2: 5njh C:246-440 [335698]
   Other proteins in same PDB: d5njha1, d5njhb1, d5njhc1, d5njhd1, d5njhe_, d5njhf1, d5njhf2, d5njhf3
   automated match to d4i50a2
   complexed with 8z8, acp, gdp, gtp, mg

Details for d5njhc2

PDB Entry: 5njh, 2.39 Å

PDB Description: triazolopyrimidines stabilize microtubules by binding to the vinca inhibitor site of tubulin

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5njhc2:

Sequence; same for both SEQRES and ATOM records:

>d5njhc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5njhc2:

• d5njhc2 first appeared in SCOPe 2.06
  
• d5njhc2 appears in SCOPe 2.07