SCOPe 2.07: Domain d5njha1: 5njh A:1-245

Lineage for d5njha1 (5njh A:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (60 PDB entries)

8. Domain d5njha1: 5njh A:1-245 [335806]
   Other proteins in same PDB: d5njha2, d5njhb2, d5njhc2, d5njhd2, d5njhe_, d5njhf1, d5njhf2, d5njhf3
   automated match to d4ihja1
   complexed with 8z8, acp, gdp, gtp, mg

Details for d5njha1

PDB Entry: 5njh, 2.39 Å

PDB Description: triazolopyrimidines stabilize microtubules by binding to the vinca inhibitor site of tubulin

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5njha1:

Sequence; same for both SEQRES and ATOM records:

>d5njha1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5njha1:

• d5njha1 first appeared in SCOPe 2.06