![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.4: Glycerol kinase [53089] (1 protein) |
![]() | Protein Glycerol kinase [53090] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53091] (13 PDB entries) |
![]() | Domain d1bu6x1: 1bu6 X:3-253 [33501] complexed with gol, so4; mutant |
PDB Entry: 1bu6 (more details), 2.37 Å
SCOPe Domain Sequences for d1bu6x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bu6x1 c.55.1.4 (X:3-253) Glycerol kinase {Escherichia coli [TaxId: 562]} kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve vltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi agdqqaalfgq
Timeline for d1bu6x1: