Lineage for d1bu6x1 (1bu6 X:3-253)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2461719Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 2461720Protein Glycerol kinase [53090] (2 species)
  7. 2461762Species Escherichia coli [TaxId:562] [53091] (14 PDB entries)
  8. 2461793Domain d1bu6x1: 1bu6 X:3-253 [33501]
    complexed with gol, so4; mutant

Details for d1bu6x1

PDB Entry: 1bu6 (more details), 2.37 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation
PDB Compounds: (X:) protein (glycerol kinase)

SCOPe Domain Sequences for d1bu6x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu6x1 c.55.1.4 (X:3-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
vltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
agdqqaalfgq

SCOPe Domain Coordinates for d1bu6x1:

Click to download the PDB-style file with coordinates for d1bu6x1.
(The format of our PDB-style files is described here.)

Timeline for d1bu6x1: