PDB entry 1bu6

View 1bu6 on RCSB PDB site
Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation
Class: transferase
Keywords: allostery, cooperativity, glycerol kinase, transferase
Deposited on 1998-08-30, released 1998-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.167
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: protein (glycerol kinase)
    Species: Escherichia coli [TaxId:562]
    Gene: GLPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F3
      • engineered (64)
    Domains in SCOPe 2.07: d1bu6o1, d1bu6o2
  • Chain 'X':
    Compound: protein (glycerol kinase)
    Species: Escherichia coli [TaxId:562]
    Gene: GLPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F3
      • engineered (64)
    Domains in SCOPe 2.07: d1bu6x1, d1bu6x2
  • Chain 'Y':
    Compound: protein (glycerol kinase)
    Species: Escherichia coli [TaxId:562]
    Gene: GLPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F3
      • engineered (64)
    Domains in SCOPe 2.07: d1bu6y1, d1bu6y2
  • Chain 'Z':
    Compound: protein (glycerol kinase)
    Species: Escherichia coli [TaxId:562]
    Gene: GLPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F3
      • engineered (64)
    Domains in SCOPe 2.07: d1bu6z1, d1bu6z2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1bu6O (O:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstl
    vevltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bu6O (O:)
    kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
    vltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
    yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
    ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
    agdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyal
    egavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyarg
    aifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfq
    sdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietternyr
    yagwkkavkramaweeh
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1bu6X (X:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstl
    vevltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bu6X (X:)
    kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
    vltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
    yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
    ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
    agdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyal
    egavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyarg
    aifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfq
    sdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietternyr
    yagwkkavkramaweehd
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1bu6Y (Y:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstl
    vevltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bu6Y (Y:)
    ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlv
    evltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
    dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
    dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisg
    iagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnya
    legavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyar
    gaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqf
    qsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietterny
    ryagwkkavkramaweehd
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1bu6Z (Z:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstl
    vevltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bu6Z (Z:)
    kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
    vltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
    yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
    ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
    agdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyal
    egavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyarg
    aifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfq
    sdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietternyr
    yagwkkavkramaweehd