Lineage for d1bu6x1 (1bu6 X:3-253)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25152Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 25153Protein Glycerol kinase [53090] (1 species)
  7. 25154Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)
  8. 25157Domain d1bu6x1: 1bu6 X:3-253 [33501]

Details for d1bu6x1

PDB Entry: 1bu6 (more details), 2.37 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

SCOP Domain Sequences for d1bu6x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu6x1 c.55.1.4 (X:3-253) Glycerol kinase {Escherichia coli}
kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
vltkadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
agdqqaalfgq

SCOP Domain Coordinates for d1bu6x1:

Click to download the PDB-style file with coordinates for d1bu6x1.
(The format of our PDB-style files is described here.)

Timeline for d1bu6x1: