Lineage for d1bu6y2 (1bu6 Y:254-500)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605693Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1605694Protein Glycerol kinase [53090] (2 species)
  7. 1605736Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
  8. 1605758Domain d1bu6y2: 1bu6 Y:254-500 [33504]
    complexed with gol, so4; mutant

Details for d1bu6y2

PDB Entry: 1bu6 (more details), 2.37 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation
PDB Compounds: (Y:) protein (glycerol kinase)

SCOPe Domain Sequences for d1bu6y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu6y2 c.55.1.4 (Y:254-500) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweehd

SCOPe Domain Coordinates for d1bu6y2:

Click to download the PDB-style file with coordinates for d1bu6y2.
(The format of our PDB-style files is described here.)

Timeline for d1bu6y2: