Lineage for d5v69b_ (5v69 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932599Domain d5v69b_: 5v69 B: [334325]
    Other proteins in same PDB: d5v69a1, d5v69a2
    automated match to d4bbnf_
    complexed with cl, na, pgo, zn

Details for d5v69b_

PDB Entry: 5v69 (more details), 2.55 Å

PDB Description: crystal structure of the middle east respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant me.4
PDB Compounds: (B:) me.4

SCOPe Domain Sequences for d5v69b_:

Sequence, based on SEQRES records: (download)

>d5v69b_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrifvetlrrltitlevepsdtienvkakiqdkegippdqqrliffgqqledgrtlsdyn
ivkystlhlilrlns

Sequence, based on observed residues (ATOM records): (download)

>d5v69b_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrifvetltitlevepsdtienvkakiqdkegippdqqrliffgqqledgrtlsdynivk
ystlhlilrlns

SCOPe Domain Coordinates for d5v69b_:

Click to download the PDB-style file with coordinates for d5v69b_.
(The format of our PDB-style files is described here.)

Timeline for d5v69b_: