SCOPe 2.08: Domain d5v69a1: 5v69 A:1481-1542

Lineage for d5v69a1 (5v69 A:1481-1542)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311415] (6 PDB entries)

8. Domain d5v69a1: 5v69 A:1481-1542 [334683]
   Other proteins in same PDB: d5v69a2, d5v69b_
   automated match to d4pt5a1
   complexed with cl, na, pgo, zn

Details for d5v69a1

PDB Entry: 5v69, 2.55 Å

PDB Description: crystal structure of the middle east respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant me.4

PDB Compounds: (A:) MERS-CoV PLpro

SCOPe Domain Sequences for d5v69a1:

Sequence; same for both SEQRES and ATOM records:

>d5v69a1 d.15.1.0 (A:1481-1542) automated matches {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
qqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladn
lt

Timeline for d5v69a1:

• d5v69a1 first appeared in SCOPe 2.06
  
• d5v69a1 appears in SCOPe 2.07