Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein automated matches [190092] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [334131] (3 PDB entries) |
Domain d5kxhb_: 5kxh B: [334189] automated match to d1f7ea_ complexed with gdp, gol, nag |
PDB Entry: 5kxh (more details), 1.33 Å
SCOPe Domain Sequences for d5kxhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kxhb_ g.3.11.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dqcasnpcqnggtcqdhlksyvcfclldfegrnceksk
Timeline for d5kxhb_: