Lineage for d1ngf_1 (1ngf 3-188)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25008Superfamily c.55.1: Actin-like ATPase domain [53067] (4 families) (S)
  5. 25009Family c.55.1.1: Actin/HSP70 [53068] (3 proteins)
  6. 25045Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 25046Species Cow (Bos taurus) [TaxId:9913] [53070] (24 PDB entries)
  8. 25077Domain d1ngf_1: 1ngf 3-188 [33405]

Details for d1ngf_1

PDB Entry: 1ngf (more details), 2.38 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment

SCOP Domain Sequences for d1ngf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngf_1 c.55.1.1 (3-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia
ygldkk

SCOP Domain Coordinates for d1ngf_1:

Click to download the PDB-style file with coordinates for d1ngf_1.
(The format of our PDB-style files is described here.)

Timeline for d1ngf_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngf_2