Lineage for d1ngfa1 (1ngf A:3-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883725Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 2883726Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 2883753Domain d1ngfa1: 1ngf A:3-188 [33405]
    complexed with atp; mutant

Details for d1ngfa1

PDB Entry: 1ngf (more details), 2.17 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment
PDB Compounds: (A:) heat-shock cognate 70 kd protein

SCOPe Domain Sequences for d1ngfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngfa1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia
ygldkk

SCOPe Domain Coordinates for d1ngfa1:

Click to download the PDB-style file with coordinates for d1ngfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ngfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngfa2