SCOPe 2.07: Domain d1ngfa1: 1ngf A:3-188

Lineage for d1ngfa1 (1ngf A:3-188)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)

8. Domain d1ngfa1: 1ngf A:3-188 [33405]
   complexed with atp; mutant

Details for d1ngfa1

PDB Entry: 1ngf, 2.17 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment

PDB Compounds: (A:) heat-shock cognate 70 kd protein

SCOPe Domain Sequences for d1ngfa1:

Sequence; same for both SEQRES and ATOM records:

>d1ngfa1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia
ygldkk

Timeline for d1ngfa1:

• d1ngfa1 first appeared (with stable ids) in SCOP 1.55, called d1ngf_1
  
• d1ngfa1 appears in SCOPe 2.06
  
• d1ngfa1 appears in the current release, SCOPe 2.08