Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) |
Superfamily c.53.2: beta-carbonic anhydrase [53056] (1 family) |
Family c.53.2.1: beta-carbonic anhydrase [53057] (1 protein) |
Protein beta-carbonic anhydrase [53058] (2 species) |
Species Pea (Pisum sativum) [TaxId:3888] [53059] (1 PDB entry) |
Domain d1ekje_: 1ekj E: [33368] |
PDB Entry: 1ekj (more details), 1.93 Å
SCOP Domain Sequences for d1ekje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekje_ c.53.2.1 (E:) beta-carbonic anhydrase {Pea (Pisum sativum)} kseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpge afvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgt ystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvn ktlalkggyydfvkgsfelwglefglsstfsv
Timeline for d1ekje_: