PDB entry 1ekj

View 1ekj on RCSB PDB site
Description: the x-ray crystallographic structure of beta carbonic anhydrase from the c3 dicot pisum sativum
Deposited on 2000-03-08, released 2000-06-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.229
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ekja_
  • Chain 'B':
    Domains in SCOP 1.55: d1ekjb_
  • Chain 'C':
    Domains in SCOP 1.55: d1ekjc_
  • Chain 'D':
    Domains in SCOP 1.55: d1ekjd_
  • Chain 'E':
    Domains in SCOP 1.55: d1ekje_
  • Chain 'F':
    Domains in SCOP 1.55: d1ekjf_
  • Chain 'G':
    Domains in SCOP 1.55: d1ekjg_
  • Chain 'H':
    Domains in SCOP 1.55: d1ekjh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekjA (A:)
    easeriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpgeaf
    vvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgtys
    tdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvnkt
    lalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekjB (B:)
    pkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpg
    eafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdg
    tystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglv
    nktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekjC (C:)
    sdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvld
    fqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsf
    pfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvr
    eglvnktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekjD (D:)
    seaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpgea
    fvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgty
    stdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvnk
    tlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekjE (E:)
    kseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpge
    afvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgt
    ystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvn
    ktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekjF (F:)
    ipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqp
    geafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfd
    gtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvregl
    vnktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekjG (G:)
    tsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpsh
    vldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgl
    lsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltyp
    fvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekjH (H:)
    seaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpgea
    fvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgty
    stdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvnk
    tlalkggyydfvkgsfelwglefglsstfsv