Lineage for d1vsra_ (1vsr A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) 
Family c.52.1.15: Very short patch repair (VSR) endonuclease [53023] (1 protein) Protein Very short patch repair (VSR) endonuclease [53024] (1 species) Species Escherichia coli [TaxId:562] [53025] (2 PDB entries) 
Domain d1vsra_: 1vsr A: [33332]
Details for d1vsra_
PDB Entry: 1vsr (more details), 1.8 Å
PDB Description: very short patch repair (vsr) endonuclease from escherichia coli
SCOP Domain Sequences for d1vsra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsra_ c.52.1.15 (A:) Very short patch repair (VSR) endonuclease {Escherichia coli}
aiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvifthgcfwhhhhcylfkvpatr
tefwlekigknverdrrdisrlqelgwrvlivwecalrgrekltdealterleewicgeg
asaqidtqgihlla
SCOP Domain Coordinates for d1vsra_:
Click to download the PDB-style file with coordinates for d1vsra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vsra_:
- d1vsra_ appears in SCOP 1.57
- d1vsra_ appears in the current release, SCOPe 2.08
View in 3D