Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.15: Very short patch repair (VSR) endonuclease [53023] (1 protein) |
Protein Very short patch repair (VSR) endonuclease [53024] (1 species) |
Species Escherichia coli [TaxId:562] [53025] (3 PDB entries) |
Domain d1vsra_: 1vsr A: [33332] complexed with zn |
PDB Entry: 1vsr (more details), 1.8 Å
SCOPe Domain Sequences for d1vsra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsra_ c.52.1.15 (A:) Very short patch repair (VSR) endonuclease {Escherichia coli [TaxId: 562]} aiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvifthgcfwhhhhcylfkvpatr tefwlekigknverdrrdisrlqelgwrvlivwecalrgrekltdealterleewicgeg asaqidtqgihlla
Timeline for d1vsra_: