Lineage for d1vsra_ (1vsr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882472Family c.52.1.15: Very short patch repair (VSR) endonuclease [53023] (1 protein)
  6. 2882473Protein Very short patch repair (VSR) endonuclease [53024] (1 species)
  7. 2882474Species Escherichia coli [TaxId:562] [53025] (3 PDB entries)
  8. 2882475Domain d1vsra_: 1vsr A: [33332]
    complexed with zn

Details for d1vsra_

PDB Entry: 1vsr (more details), 1.8 Å

PDB Description: very short patch repair (vsr) endonuclease from escherichia coli
PDB Compounds: (A:) protein (vsr endonuclease)

SCOPe Domain Sequences for d1vsra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsra_ c.52.1.15 (A:) Very short patch repair (VSR) endonuclease {Escherichia coli [TaxId: 562]}
aiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvifthgcfwhhhhcylfkvpatr
tefwlekigknverdrrdisrlqelgwrvlivwecalrgrekltdealterleewicgeg
asaqidtqgihlla

SCOPe Domain Coordinates for d1vsra_:

Click to download the PDB-style file with coordinates for d1vsra_.
(The format of our PDB-style files is described here.)

Timeline for d1vsra_: