Lineage for d1dfma_ (1dfm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882360Family c.52.1.5: Restriction endonuclease BglII [52993] (1 protein)
  6. 2882361Protein Restriction endonuclease BglII [52994] (1 species)
  7. 2882362Species Bacillus subtilis [TaxId:1423] [52995] (3 PDB entries)
  8. 2882365Domain d1dfma_: 1dfm A: [33295]
    protein/DNA complex; complexed with ca

Details for d1dfma_

PDB Entry: 1dfm (more details), 1.5 Å

PDB Description: crystal structure of restriction endonuclease bglii complexed with dna 16-mer
PDB Compounds: (A:) endonuclease bglii

SCOPe Domain Sequences for d1dfma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfma_ c.52.1.5 (A:) Restriction endonuclease BglII {Bacillus subtilis [TaxId: 1423]}
mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty

SCOPe Domain Coordinates for d1dfma_:

Click to download the PDB-style file with coordinates for d1dfma_.
(The format of our PDB-style files is described here.)

Timeline for d1dfma_: