Lineage for d1dfma_ (1dfm A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) 
Family c.52.1.5: Restriction endonuclease BglII [52993] (1 protein) Protein Restriction endonuclease BglII [52994] (1 species) Species Bacillus subtilis [TaxId:1423] [52995] (3 PDB entries) 
Domain d1dfma_: 1dfm A: [33295]
Details for d1dfma_
PDB Entry: 1dfm (more details), 1.5 Å
PDB Description: crystal structure of restriction endonuclease bglii complexed with dna 16-mer
SCOP Domain Sequences for d1dfma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfma_ c.52.1.5 (A:) Restriction endonuclease BglII {Bacillus subtilis}
mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty
SCOP Domain Coordinates for d1dfma_:
Click to download the PDB-style file with coordinates for d1dfma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dfma_:
- d1dfma_ appears in SCOP 1.57
- d1dfma_ appears in the current release, SCOPe 2.08
View in 3D
