PDB entry 1dfm

View 1dfm on RCSB PDB site
Description: Crystal structure of restriction endonuclease BGLII complexed with DNA 16-mer
Class: hydrolase/DNA
Keywords: restriction endonuclease, restriction enzyme, protein-DNA complex, hydrolase/DNA complex
Deposited on 1999-12-06, released 2000-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease bglii
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfma_
  • Chain 'B':
    Compound: endonuclease bglii
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfmb_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*tp*tp*ap*tp*ap*gp*ap*tp*cp*tp*ap*tp*ap*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*tp*tp*ap*tp*ap*gp*ap*tp*cp*tp*ap*tp*ap*a)-3')
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfmA (A:)
    mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
    lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
    eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
    vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dfmB (B:)
    mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
    lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
    eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
    vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfmB (B:)
    mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
    lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
    eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
    vsttyadkrysrtitkrdtvkgkvidtntrkrgtivty
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.