Lineage for d1bam__ (1bam -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24836Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)
  6. 24837Protein Restriction endonuclease BamHI [52988] (1 species)
  7. 24838Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)
  8. 24839Domain d1bam__: 1bam - [33285]

Details for d1bam__

PDB Entry: 1bam (more details), 1.95 Å

PDB Description: structure of restriction endonuclease bamhi phased at 1.95 angstroms resolution by mad analysis

SCOP Domain Sequences for d1bam__:

Sequence, based on SEQRES records: (download)

>d1bam__ c.52.1.3 (-) Restriction endonuclease BamHI {Bacillus amyloliquefaciens}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkwkdkvenk

Sequence, based on observed residues (ATOM records): (download)

>d1bam__ c.52.1.3 (-) Restriction endonuclease BamHI {Bacillus amyloliquefaciens}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpidvykefienselkrvgmefetgnissahrsmnklllglkh
geidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfnaeaynsnvplipk
gsdgmskrsikkwkdkvenk

SCOP Domain Coordinates for d1bam__:

Click to download the PDB-style file with coordinates for d1bam__.
(The format of our PDB-style files is described here.)

Timeline for d1bam__: