Lineage for d1bama_ (1bam A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121212Family c.52.1.3: Restriction endonuclease BamHI [52987] (1 protein)
    automatically mapped to Pfam PF02923
  6. 2121213Protein Restriction endonuclease BamHI [52988] (1 species)
  7. 2121214Species Bacillus amyloliquefaciens [TaxId:1390] [52989] (5 PDB entries)
  8. 2121215Domain d1bama_: 1bam A: [33285]

Details for d1bama_

PDB Entry: 1bam (more details), 1.95 Å

PDB Description: structure of restriction endonuclease bamhi phased at 1.95 angstroms resolution by mad analysis
PDB Compounds: (A:) ENDONUCLEASE BamH I

SCOPe Domain Sequences for d1bama_:

Sequence, based on SEQRES records: (download)

>d1bama_ c.52.1.3 (A:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens [TaxId: 1390]}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
aeaynsnvplipkgsdgmskrsikkwkdkvenk

Sequence, based on observed residues (ATOM records): (download)

>d1bama_ c.52.1.3 (A:) Restriction endonuclease BamHI {Bacillus amyloliquefaciens [TaxId: 1390]}
mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
kelcytlledtynwyrekpidvykefienselkrvgmefetgnissahrsmnklllglkh
geidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfnaeaynsnvplipk
gsdgmskrsikkwkdkvenk

SCOPe Domain Coordinates for d1bama_:

Click to download the PDB-style file with coordinates for d1bama_.
(The format of our PDB-style files is described here.)

Timeline for d1bama_: