Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
Domain d5mj6b4: 5mj6 B:707-1025 [332733] Other proteins in same PDB: d5mj6a1, d5mj6a2, d5mj6a3, d5mj6a5, d5mj6b1, d5mj6b2, d5mj6b3, d5mj6b5 automated match to d4pj6a4 complexed with 7o2, bma, br, man, nag, zn |
PDB Entry: 5mj6 (more details), 2.53 Å
SCOPe Domain Sequences for d5mj6b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mj6b4 a.118.1.0 (B:707-1025) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapit ealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsallef acthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisigs eaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfvk enwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqealev iqlniqwmeknlksltwwl
Timeline for d5mj6b4: