SCOPe 2.07: Domain d5mj6b3: 5mj6 B:616-706

Lineage for d5mj6b3 (5mj6 B:616-706)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.0: automated matches [254306] (1 protein)
   not a true family

6. Protein automated matches [254707] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)

8. Domain d5mj6b3: 5mj6 B:616-706 [332732]
   Other proteins in same PDB: d5mj6a1, d5mj6a2, d5mj6a4, d5mj6a5, d5mj6b1, d5mj6b2, d5mj6b4, d5mj6b5
   automated match to d4pj6a3
   complexed with 7o2, bma, br, man, nag, zn

Details for d5mj6b3

PDB Entry: 5mj6, 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.

PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6b3:

Sequence, based on SEQRES records:

>d5mj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld
kksgvinlteevlwvkvninmngyyivhyad

Sequence, based on observed residues (ATOM records):

>d5mj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnsylwhiplsyvtegrnyskyqsvslldkksgvinlte
evlwvkvninmngyyivhyad

Timeline for d5mj6b3:

• d5mj6b3 first appeared in SCOPe 2.06
  
• d5mj6b3 appears in the current release, SCOPe 2.08