Lineage for d5mj6b3 (5mj6 B:616-706)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2766997Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2767009Domain d5mj6b3: 5mj6 B:616-706 [332732]
    Other proteins in same PDB: d5mj6a1, d5mj6a2, d5mj6a4, d5mj6a5, d5mj6b1, d5mj6b2, d5mj6b4, d5mj6b5
    automated match to d4pj6a3
    complexed with 7o2, br, nag, zn

Details for d5mj6b3

PDB Entry: 5mj6 (more details), 2.53 Å

PDB Description: ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity.
PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d5mj6b3:

Sequence, based on SEQRES records: (download)

>d5mj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld
kksgvinlteevlwvkvninmngyyivhyad

Sequence, based on observed residues (ATOM records): (download)

>d5mj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnsylwhiplsyvtegrnyskyqsvslldkksgvinlte
evlwvkvninmngyyivhyad

SCOPe Domain Coordinates for d5mj6b3:

Click to download the PDB-style file with coordinates for d5mj6b3.
(The format of our PDB-style files is described here.)

Timeline for d5mj6b3: