![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
![]() | Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
![]() | Protein automated matches [254707] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
![]() | Domain d5mj6b3: 5mj6 B:616-706 [332732] Other proteins in same PDB: d5mj6a1, d5mj6a2, d5mj6a4, d5mj6a5, d5mj6b1, d5mj6b2, d5mj6b4, d5mj6b5 automated match to d4pj6a3 complexed with 7o2, br, nag, zn |
PDB Entry: 5mj6 (more details), 2.53 Å
SCOPe Domain Sequences for d5mj6b3:
Sequence, based on SEQRES records: (download)
>d5mj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld kksgvinlteevlwvkvninmngyyivhyad
>d5mj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplvtvqkkgkelfiqqerfflnsylwhiplsyvtegrnyskyqsvslldkksgvinlte evlwvkvninmngyyivhyad
Timeline for d5mj6b3: